PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 273aa    MW: 29986.9 Da    PI: 8.6444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0188genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
      Gh_A06G0188 12 KGPWSPEEDEALQRLVQTYGPRNWTLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding54.42.9e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a+++ G++ W+tIar ++ gRt++ +k++w++ 
      Gh_A06G0188  66 PFTPEEDDTIIRAHARVGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.191762IPR017930Myb domain
SuperFamilySSF466898.99E-339105IPR009057Homeodomain-like
SMARTSM007173.7E-171160IPR001005SANT/Myb domain
PfamPF002491.9E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-261365IPR009057Homeodomain-like
CDDcd001671.40E-161456No hitNo description
SMARTSM007171.8E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129420.97364113IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2366112IPR009057Homeodomain-like
CDDcd001678.14E-1266109No hitNo description
PfamPF002495.0E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MASTRKDMDR IKGPWSPEED EALQRLVQTY GPRNWTLISK SIPGRSGKSC RLRWCNQLSP  60
EVEHRPFTPE EDDTIIRAHA RVGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCLSMTEGF  120
NDDSPQPLKR SASLGTGNPS SPSGSDLSDS SLPAPSPAFK TGSLVPLSQH VETASSATDP  180
PTLLSLSLPG SDFTEPVSPP GFNPTQVTTQ ASAPVPAPVE KQFFSAEFFA VMKEMIRKEV  240
RSYMAGIEQN ELCLQTEAIR NAVVKRIGIS KIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-42111133105C-Myb DNA-Binding Domain
1msf_C5e-42111133105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.95880.0boll| leaf| ovule| root| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5860781e-51JX586078.1 Gossypium hirsutum clone NBRI_GE19816 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451049.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-82MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2V4H60.0A0A0D2V4H6_G
STRINGPOPTR_0002s12410.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-73myb domain protein 73